PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG012400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 355aa    MW: 40213.9 Da    PI: 9.7504
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG012400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.31.6e-14251051497
                          T-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3  14 grlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                            +++p +f++++  ++  +s+t ++ ++ g+ W+++l  +++++++++++GW +F + +g+  gD+++++++g++ f  +vk+f
  Pavir.7KG012400.1.p  25 EKMIIPARFVKHYvTEEYLNSRTAVILSPLGKLWQIEL--ENNPSGMFFAGGWPQFLEFHGISKGDVLLLRYEGNMVF--KVKAF 105
                          459*******999844445889****************..**********************************9999..77766 PP

2B352.49.4e-17182261586
                          -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                   B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                          +++ ++l++ +l lp kf+  +g + ++++tl+ e  s rsW+v    + k  +++l++GWk+F+++n+Lk+gD ++F+ ++
  Pavir.7KG012400.1.p 182 EIHTYALER-LLPLPIKFCHGIGFNGTCTITLKTEIDSTRSWQVHGA-TYKTYGCMLGDGWKSFCRENRLKTGDLCTFHIVE 261
                          555666665.599******98888877877777777888*******3.33334599***********************654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.9E-1811108IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-1812108IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.5912108IPR003340B3 DNA binding domain
SMARTSM010191.1E-1115108IPR003340B3 DNA binding domain
PfamPF023623.6E-1224104IPR003340B3 DNA binding domain
CDDcd100173.07E-1524105No hitNo description
SMARTSM010197.9E-4179273IPR003340B3 DNA binding domain
SuperFamilySSF1019362.75E-16183271IPR015300DNA-binding pseudobarrel domain
CDDcd100179.46E-11184271No hitNo description
Gene3DG3DSA:2.40.330.102.9E-15184271IPR015300DNA-binding pseudobarrel domain
PfamPF023621.5E-13191269IPR003340B3 DNA binding domain
PROSITE profilePS5086311.307192273IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MASRSSKGVS CKPQFIRIVY PNLSEKMIIP ARFVKHYVTE EYLNSRTAVI LSPLGKLWQI  60
ELENNPSGMF FAGGWPQFLE FHGISKGDVL LLRYEGNMVF KVKAFGLNGH QKDFKNQDTG  120
ILQNVEMQQE PLSPTRKRKN NDEKSSSEEN KRPKSSVTYL SPKLPPKNPD YQIGPSSWIR  180
KEIHTYALER LLPLPIKFCH GIGFNGTCTI TLKTEIDSTR SWQVHGATYK TYGCMLGDGW  240
KSFCRENRLK TGDLCTFHIV ETTLWHVTIK RSLTSADTEN RKETPCSSNK EQETKKVNPS  300
SEERVRPKGS TNSLSKASKY KRSVYEIGPP FLGTEGDELQ LNSKASYFAT ELLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977886.21e-170PREDICTED: putative B3 domain-containing protein Os04g0347400
TrEMBLK3Y7G41e-167K3Y7G4_SETIT; Uncharacterized protein
STRINGSi010155m1e-167(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.14e-18B3 family protein